PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 190aa    MW: 21356.3 Da    PI: 9.9673
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016563genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.65.2e-211156348
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 ++++s  qvtfskRr+g++KKA+EL +LC+++va++ifs+ gk + 
  Lus10016563 11 VKDSSSLQVTFSKRRTGLFKKAHELATLCAVKVALLIFSPGGKPFS 56
                 6889999*********************************998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.399161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-26173IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-32160IPR002100Transcription factor, MADS-box
CDDcd002653.52E-32276No hitNo description
PRINTSPR004046.8E-19323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-221157IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MGRRKIEMEM VKDSSSLQVT FSKRRTGLFK KAHELATLCA VKVALLIFSP GGKPFSFGSP  60
DFDDVTEKFL TQDENSDEDA YDIDHNNQAG IATQNKNRRL DMLQHQIELE KKKMSDMKKD  120
GTKSKLLKSL KKMKLNELVN VKNKSTRLQK ELAGRTMEIE ASTTLMHLSE KKSTATNENY  180
ESSSSSSTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-16169169Myocyte-specific enhancer factor 2B
1tqe_Q6e-16169169Myocyte-specific enhancer factor 2B
1tqe_R6e-16169169Myocyte-specific enhancer factor 2B
1tqe_S6e-16169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025122.16e-44Agamous-like MADS-box protein A, putative
TrEMBLA0A061GKZ36e-44A0A061GKZ3_THECC; Agamous-like MADS-box protein A, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-38AGAMOUS-like 29